beta-1,4-Galactosyltransferase 1/B4GalT1 Recombinant Protein Antigen

Name beta-1,4-Galactosyltransferase 1/B4GalT1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-88655PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody beta-1,4-Galactosyltransferase 1/B4GalT1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene B4GALT1
Sequence FRGMSISRPNAVVGRCRMIRHSRDKKNEPNPQRFDRIAHTKETMLSDGLNSLTYQVLDVQRYPLYTQITVDIGTPS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human B4GALT1
Supplier Page Shop