Neurexin 3/NRXN3 Recombinant Protein Antigen

Name Neurexin 3/NRXN3 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-88424PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody Neurexin 3/NRXN3 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene NRXN3
Sequence LTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSVRLVGEVPSILGTTQTTSMPPEMSTTVMETTTTMATTTTRKNRSTASIQPTSDDLVSSAECSSDDEDFVECEPSTANPTEP
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NRXN3
Supplier Page Shop