SEC61B Recombinant Protein Antigen

Name SEC61B Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-13290PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody SEC61B Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SEC61B
Sequence AAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLK
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SEC61B. Source: E.coli Amino Acid Sequence: AAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLK
Supplier Page Shop