CCP110 Recombinant Protein Antigen

Name CCP110 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-13073PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CCP110 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CCP110
Sequence DKPSLNKSNVLLQGASTQASSMSMPVLASFSKVDIPIRTGHPTVLESNSDFKVIPTFVTENNVIKSLTGSYAKLPSPEPSMSPKMHRRRSRTSSACHILINNPINACELSPKGK
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CCP110
Supplier Page Shop