NOP58 Recombinant Protein Antigen

Name NOP58 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-81680PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody NOP58 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene NOP58
Sequence LDKELNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASAKLSELLPEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPNVTVMVGELVGARLIAHAGSLL
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NOP58
Supplier Page Shop