Cytokeratin, HMW Recombinant Protein Antigen

Name Cytokeratin, HMW Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-81647PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody Cytokeratin, HMW Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene KRT76
Sequence LETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLGERGNLEGELKSMQDLVEDFK
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KRT76
Supplier Page Shop