HCA59 Recombinant Protein Antigen

Name HCA59 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-83168PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody HCA59 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C9orf78
Sequence MPVVRKIFRRRRGDSESEEDEQDSEEVRLKLEETREVQNLRKRPNGVSAVALLVGEKVQEETTLVDDPFQMKTGGMVDMKKLKE
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C9ORF78
Supplier Page Shop