Use1/UBE2Z Recombinant Protein Antigen

Name Use1/UBE2Z Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-82785PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody Use1/UBE2Z Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene USE1
Sequence RSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQSAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVNW
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human USE1
Supplier Page Shop