AMPD1 Recombinant Protein Antigen

Name AMPD1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-81270PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody AMPD1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene AMPD1
Sequence SETSSTKLSHIDEYISSSPTYQTVPDFQRVQITGDYASGVTVEDFEIVCKGLYRALCIREKYMQKSFQRFPKTPSKYLRNIDGEAWVANE
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AMPD1
Supplier Page Shop