Nurr1/NGFI-B beta/NR4A2 Recombinant Protein Antigen

• Supplier: Novus Biologicals
• Catalog: NBP1-87765PEP
• Category: Protein
• Prices: $199.00
• Sizes: 100 µl
• For Antibody: Nurr1/NGFI-B beta/NR4A2 Antibody
• Species Reactivities: Human
• Nature: Recombinant
• Source: E.coli
• Purity: >80% by SDS-PAGE and Coomassie blue staining
• Gene: NR4A2
• Sequence: VQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKP
• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NR4A2