CART1 Recombinant Protein Antigen

Name CART1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-88189PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CART1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ALX1
Sequence DNESFYSKASAGKCVQAFGPLPRAEHHVRLERTSPCQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKGMQEKGELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYP
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ALX1
Supplier Page Shop