LNK/SH2B3 Recombinant Protein Antigen

Name LNK/SH2B3 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-87867PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody LNK/SH2B3 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SH2B3
Sequence FDPPKSSRPKLQAACSSIQEVRRCTRLEMPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMAELSECTGRGLESTEAEMHIPSALEPSTSSSPRGSTDSLNQGASPGGLLDPACQKTDHFLSCYPWFH
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SH2B3
Supplier Page Shop