FMNL2 Recombinant Protein Antigen

Name FMNL2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-83901PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody FMNL2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene FMNL2
Sequence ERVEELEENISHLSEKLQDTENEAMSKIVELEKQLMQRNKELDVVREIYKDANTQVHTLRKMVKEKEEAIQRQSTLEKKIHELEKQGTIKIQKKGDGDIAILPVVASGTLSMGSEVVAGNSVGP
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FMNL2
Supplier Page Shop