MRPS10 Recombinant Protein Antigen

Name MRPS10 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-83847PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody MRPS10 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene MRPS10
Sequence TAFGAVCRRLWQGLGNFSVNTSKGNTAKNGGLLLSTNMKWVQFSNLHVDVPKDLTKPVVTISDE
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRPS10
Supplier Page Shop