KLC2 Recombinant Protein Antigen

Name KLC2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-83722PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody KLC2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene KLC2
Sequence TLEDCASRNRKQGLDPASQTKVVELLKDGSGRRGDRRSSRDMAGGAGPRSESDLEDVGPTAEWNG
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KLC2
Supplier Page Shop