MORC1 Recombinant Protein Antigen

Name MORC1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84351PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody MORC1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene MORC1
Sequence LSSFELSASRRGQKRNIEETDSDVEYISETKIMKKSMEEKMNSQQQRIPVALPENVKLAERSQRSQIANITTVWRAQPTEGCLKNAQAASWEMKRKQ
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MORC1
Supplier Page Shop