Zinc finger protein 470 Recombinant Protein Antigen

Name Zinc finger protein 470 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84324PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody Zinc finger protein 470 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ZNF470
Sequence KDPWVIKGGMNRGLCPDLECVWVTKSLSLNQDIYEEKLPPAIIMERLKSYDLECSTLGKNWKCEDLFE
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF470
Supplier Page Shop