BAD-LAMP/LAMP5 Recombinant Protein Antigen

Name BAD-LAMP/LAMP5 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84246PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody BAD-LAMP/LAMP5 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene LAMP5
Sequence FIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LAMP5
Supplier Page Shop