CYB5R1 Recombinant Protein Antigen

Name CYB5R1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-83145PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CYB5R1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CYB5R1
Sequence TLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEP
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CYB5R1
Supplier Page Shop