CNOT3 Recombinant Protein Antigen

Name CNOT3 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-82971PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody CNOT3 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CNOT3
Sequence TPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CNOT3
Supplier Page Shop