TBC1D1 Recombinant Protein Antigen

Name TBC1D1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-82928PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody TBC1D1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TBC1D1
Sequence ENDLLNKRLKLDYEEITPCLKEVTTVWEKMLSTPGRSKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQFHLKHQFPSKQQPKD
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TBC1D1
Supplier Page Shop