TRMT5 Recombinant Protein Antigen

Name TRMT5 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-82909PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody TRMT5 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TRMT5
Sequence DGKDFLQGPVKEELMQLLGLSKERKPSVHVVMNLPAKAIEFLSAFKWLLDGQPCSSEFLPIVHCYSFSKDANPAEDVRQRAGAVLGISLEACSSVHLVRNVAPNKEMLCITFQIPASVLYKNQTRNPENHEDPPLKR
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRMT5
Supplier Page Shop