RPL12 Recombinant Protein Antigen

Name RPL12 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-82857PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody RPL12 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene RPL12
Sequence KVVYLRCTGGEVGATSALAPKIGPLGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDIIDD
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RPL12
Supplier Page Shop