C3orf18 Recombinant Protein Antigen

Name C3orf18 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-83405PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody C3orf18 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C3orf18
Sequence KKKRLEKLRHQLMPMYNFDPTEEQDELEQELLEHGRDAASVQAATSVQAMQGKTTLPSQGPLQRPSRLVFTDVANAIHA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C3ORF18
Supplier Page Shop