RASL10B Recombinant Protein Antigen

Name RASL10B Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-38817PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody RASL10B Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene RASL10B
Sequence KSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVN
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human RASL10B. Source: E.coli Amino Acid Sequence: KSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVN
Supplier Page Shop