N-PAC Recombinant Protein Antigen

Name N-PAC Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-38576PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody N-PAC Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene GLYR1
Sequence IVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQLKPYHAHKEEMIKINKGKRFQQAVDAVEEFLRRAKGKDQTSSHNSSD
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GLYR1
Supplier Page Shop