Potassium channel subfamily K member 6 Recombinant Protein Antigen

• Supplier: Novus Biologicals
• Catalog: NBP2-34063PEP
• Category: Protein
• Prices: $199.00
• Sizes: 100 µl
• For Antibody: Potassium channel subfamily K member 6 Antibody
• Species Reactivities: Human
• Nature: Recombinant
• Source: E.coli
• Purity: >80% by SDS-PAGE and Coomassie blue staining
• Gene: KCNK6
• Sequence: LQTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQLSASSHTDY
• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KCNK6