P2Y9 Recombinant Protein Antigen

Name P2Y9 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-33734PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody P2Y9 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene LPAR4
Sequence KSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNNGGELM
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LPAR4
Supplier Page Shop