C5orf24 Recombinant Protein Antigen

Name C5orf24 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-31686PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody C5orf24 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C5orf24
Sequence KPSCLNEDAMRAADQFDIYSSQQSKYSHTVNHKPMVCQRQDPLNETHLQTTSGRSIEIKDELKKKKNLNRSGKRG
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C5ORF24
Supplier Page Shop