ZNF322A Recombinant Protein Antigen

Name ZNF322A Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-33384PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody ZNF322A Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ZNF322P1
Sequence QRIHMEEKPHQWSACESGFLLGMDFVAQQKMRTQTEELHYKYTVCD
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF322
Supplier Page Shop