XPG Recombinant Protein Antigen

Name XPG Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-47578PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody XPG Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ERCC5
Sequence EKEFELLDKAKRKTQKRGITNTLEESSSLKRKRLSDSKRKNTCGGFLGETCLSESSDGSSSEDAESSSLMNVQRRTAAKEPKTSASDSQNSVKEAPVK
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ERCC5
Supplier Page Shop