BTBD8 Recombinant Protein Antigen

Name BTBD8 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-38246PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody BTBD8 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene BTBD8
Sequence TSNSLTNQEPIAVENVEALEFRTFLQIIYSSNRNIKNYEEEILRKKIMEIGISQKQLDISFPKCENSSDCSLQKHEIPEDISDRDDDFISNDNYDLEP
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BTBD8
Supplier Page Shop