bcl10-interacting CARD protein Recombinant Protein Antigen

Name bcl10-interacting CARD protein Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-38125PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody bcl10-interacting CARD protein Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C9orf89
Sequence MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALQNSDCTELDSGSQSGELSNR
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C9ORF89
Supplier Page Shop