SEZ6L2/BSRP-A Recombinant Protein Antigen

Name SEZ6L2/BSRP-A Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-38051PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody SEZ6L2/BSRP-A Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SEZ6L2
Sequence RGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFSCLPGYALEPPGPPNAIECV
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SEZ6L2
Supplier Page Shop