C2orf48 Recombinant Protein Antigen

Name C2orf48 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-37981PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody C2orf48 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C2orf48
Sequence MESRPSGRQHASEGDGDQSPTQCAGMRSSGRSDQPYALKGNPLLLRVRCYSGCASGSGRQLQLSVFQDLNQFSHCRVWRS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C2ORF48
Supplier Page Shop