P4HA2 Recombinant Protein Antigen

Name P4HA2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-33909PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody P4HA2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene P4HA2
Sequence LDYLSYAVFQLGDLHRALELTRRLLSLDPSHERAGGNLRYFEQLLEEEREKTLTNQTEAELATPEGIYERPVDYLPERDVYESLCRGEGVKLTPRRQKRLFCRYHHGNRAPQLLIAPFKEEDEWDSPHIVRYYDVMS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human P4HA2
Supplier Page Shop