ACSF2 Recombinant Protein Antigen

Name ACSF2 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP2-47558PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody ACSF2 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene ACSF2
Sequence GTLAKLNTPGELCIRGYCVMLGYWGEPQKTEEAVDQDKWYWTGDVATMNEQGFCKIVGRSKDMIIRGGEN
Description A recombinant antigen with a N-terminal His6-ABP tag protein corresponding to human ACSF2
Supplier Page Shop