KIAA1143 Recombinant Protein Antigen

Name KIAA1143 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-92051PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody KIAA1143 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene KIAA1143
Sequence IKAEIKAAKADEEPTPADGRIIYRKPVKHPSDEKYSGLTASSKKKKPNEDEVNQDSVK
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIAA1143
Supplier Page Shop