SLC45A3/Prostein Recombinant Protein Antigen

Name SLC45A3/Prostein Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-89629PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody SLC45A3/Prostein Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SLC45A3
Sequence PKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEP
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC45A3
Supplier Page Shop