K0100 Recombinant Protein Antigen

Name K0100 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-89999PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody K0100 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene KIAA0100
Sequence EHPVDDIDKMKERAAMNNSFIYIKIPQVPLCVSYKGEKNSVDWGDLNLVLPCLEYHNNTWTWLDFAMAVKRDSRKALVAQVIKEKLRLKSATGSEVRGKLETKSDLN
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIAA0100
Supplier Page Shop