HS747E2A Recombinant Protein Antigen

Name HS747E2A Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-89963PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody HS747E2A Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C22orf31
Sequence LTVRQDLEDRYAEHVAATQALPQDSGTAAWKGRVLLPETQKRQQLSEDTLTIHGLPTEGYQALYHAVVEPMLWNPSGTPKRYSLELGKAIKQKLWEALCSQGAISEGAQRDRFPGRKQPGVHEEPVLKKWPKLKSK
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C22ORF31
Supplier Page Shop