PIPPIN Recombinant Protein Antigen

Name PIPPIN Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-87271PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody PIPPIN Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene CSDC2
Sequence PTFPFHREGSRVWERGGVPPRDLPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCPIPPKNQ
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CSDC2
Supplier Page Shop