D4S234E Recombinant Protein Antigen

Name D4S234E Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-87425PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody D4S234E Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene NSG1
Sequence CPDGFVLKNTQCIPEGLESYYAEQDSSAREKFYTVINHYNLAKQSITRSVSPWMSVLSEEKLSEQETEAAEKS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NSG1
Supplier Page Shop