PPP1R14D/GBPI-1 Recombinant Protein Antigen

Name PPP1R14D/GBPI-1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-85484PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody PPP1R14D/GBPI-1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene PPP1R14D
Sequence ENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCP
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP1R14D. Source: E.coli Amino Acid Sequence: ENPCKKVHWASGRRRTSSTDSESKSHPDSSKIPRSRRPSRLTVKYDRGQLQRWLEMEQWVDAQVQELFQDQATPSEPEIDLEALMDLSTEEQKTQLEAILGNCP
Supplier Page Shop