C14orf80 Recombinant Protein Antigen

Name C14orf80 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-85864PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody C14orf80 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene C14orf80
Sequence PAPHMEAEGPVDVRHVQWLMGKLRFRWRQLVSSQQEQCALLSKIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQVSGAGAAQNLDLA
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human C14ORF80
Supplier Page Shop