Tripeptidyl peptidase II Recombinant Protein Antigen

Name Tripeptidyl peptidase II Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-86022PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody Tripeptidyl peptidase II Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene TPP2
Sequence SSQANKLIKEELQSQVELLNSFEKKYSDPGPVYDCLVWHDGEVWRACIDSNEDGDLSKSTVLRNYKEAQEYGSFGTAEMLNYSVNIYDDGNLLSIVTSGGAHGTHVASIAAGHFPEEPERNGVAPGAQILSIKIGDTRLST
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TPP2
Supplier Page Shop