MLLT1 Recombinant Protein Antigen

Name MLLT1 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84840PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody MLLT1 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene MLLT1
Sequence MVMPEGADTVSRPSPDYPMLPTIPLSAFSDPKKTKPSHGSKDANKESSKTSKPHKVTKEHRERPRKDSESKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAAFKEPKMALKE
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MLLT1
Supplier Page Shop