SEC62 Recombinant Protein Antigen

Name SEC62 Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84045PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody SEC62 Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene SEC62
Sequence GGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSS
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SEC62
Supplier Page Shop