SKT Recombinant Protein Antigen

Name SKT Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84100PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody SKT Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene KIAA1217
Sequence KEEPHKLDSLLKRVRSMTDVLTMLRRHVTDGLLKGTDAAQAAQYMAMEKATAAEVLKSQEEAAHTSGQPFHSTGAPGDAKSEVVPLSGMMVRHAQSSPVVIQPSQ
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KIAA1217
Supplier Page Shop