IGSF6/DORA Recombinant Protein Antigen

Name IGSF6/DORA Recombinant Protein Antigen
Supplier Novus Biologicals
Catalog NBP1-84061PEP
Category Protein
Prices $199.00
Sizes 100 µl
For Antibody IGSF6/DORA Antibody
Species Reactivities Human
Nature Recombinant
Source E.coli
Purity >80% by SDS-PAGE and Coomassie blue staining
Gene IGSF6
Sequence VTIKCTFSATGCPSEQPTCLWFRYGAHQPENLCLDGCKSEADKFTVREALKENQVSLTVNRVTSNDSAIYICGIAFPSVPEARAKQTGGGTTLVVREIKLLSK
Description A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IGSF6
Supplier Page Shop